LL-37 (Human Cathelicidin) – Synthetic 37-Amino Acid Peptide | Research Use Only

LL-37 is a synthetic 37-amino acid peptide corresponding to the active fragment of the human cathelicidin antimicrobial peptide precursor (hCAP18 / CAMP). It is classified as a cationic, amphipathic antimicrobial peptide (AMP) and represents the only cathelicidin identified in humans.

In research literature, LL-37 is studied as a host-defense peptide involved in innate immune signaling and peptide-mediated cellular response pathways.

Research Use Only: This material is supplied strictly for laboratory developmental research use. It is not intended for human or veterinary consumption.

Scientific Classification

• Common Name: LL-37 (human)
• Synonyms: Ropocamptide; CAP18; CAMP; hCAP18 (precursor protein)
• Classification: Cationic, amphipathic antimicrobial peptide (AMP)
• Family: Cathelicidin
• Peptide Length: 37 amino acids

Chemical & Structural Information

• Amino Acid Sequence: [LL-37, 37 aa]
• Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃
• Molecular Weight: ~4493.3 Da (g/mol)
• Structure Type: Linear cationic amphipathic peptide

Research Context

Within controlled laboratory environments, LL-37 has been examined in studies involving:

• Innate immune signaling models
• Host-defense peptide research
• Cell membrane interaction studies
• Inflammatory pathway investigations
• Wound-associated cellular signaling research

LL-37 is frequently referenced in literature evaluating antimicrobial peptide (AMP) structure-activity relationships and immunomodulatory signaling mechanisms in vitro.

No therapeutic or medical claims are made. All descriptions above are limited strictly to laboratory and investigational research contexts.

Product Classification

• Category: Synthetic Research Peptide
• Form: Research-grade raw material (refer to product label for preparation details)
• Intended Use: Laboratory and developmental research only

Regulatory Status

This product is not approved by the U.S. Food and Drug Administration (FDA) for the diagnosis, treatment, cure, or prevention of any disease.

This material is sold exclusively for laboratory research purposes.

FDA Disclaimer

The statements made within this website have not been evaluated by the US Food and Drug Administration. The statements and the products of this company are not intended to diagnose, treat, cure or prevent any disease.

The information in this website is for educational purposes only and is not intended as medical or research advice.

Research Use Only

All products are for laboratory developmental research USE ONLY. Products are not for human consumption. Use of these products in such a manner other than research violates the terms of service.

Legal Disclaimer

This product is sold as a pure compound for research purposes only and is not for use as a dietary supplement. Please refer to the terms and conditions prior to purchase.

Safety Information

Keep this product out of the reach of children. This material has limited research available and may result in adverse effects if improperly handled or consumed.

This product is not a dietary supplement but a pure substance sold as a raw material. We attest to the quality, purity, and description of the materials we provide. This product is intended for persons with the knowledge and equipment to safely handle laboratory materials.

You agree to indemnify us for any adverse effects that may arise from improper handling and/or consumption of this product.

The articles and information on products that may be found on this website are provided exclusively for informational and educational purposes. These items are not pharmaceuticals or medications, and the Food and Drug Administration has not given permission for the treatment or prevention of any disease, medical condition, or ailment using them.